PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_CA02DC5B2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 382aa    MW: 41050.2 Da    PI: 7.404
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_CA02DC5B2.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.3e-171360148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg W++eEde+l+++++ +G  +W+++++  g+ R++k+c++rw +yl
  Traes_2BS_CA02DC5B2.1 13 RGLWSPEEDERLLRYITAHGHSCWSAVPKNAGLQRCGKSCRLRWINYL 60
                           788*******************************************97 PP

2Myb_DNA-binding49.97.3e-1666109146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg ++++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Traes_2BS_CA02DC5B2.1  66 RGTFSEQEERTILDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                            899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-26463IPR009057Homeodomain-like
PROSITE profilePS5129417.027860IPR017930Myb domain
SuperFamilySSF466897.49E-2810107IPR009057Homeodomain-like
SMARTSM007171.3E-121262IPR001005SANT/Myb domain
PfamPF002497.5E-151360IPR001005SANT/Myb domain
CDDcd001676.01E-111660No hitNo description
PROSITE profilePS5129425.33861115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2464116IPR009057Homeodomain-like
SMARTSM007172.1E-1565113IPR001005SANT/Myb domain
PfamPF002491.2E-1466109IPR001005SANT/Myb domain
CDDcd001671.79E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGHQCCSKQK VKRGLWSPEE DERLLRYITA HGHSCWSAVP KNAGLQRCGK SCRLRWINYL  60
RPDLKRGTFS EQEERTILDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGL  120
DPKTHNLLPA SKHLLHAHGG TGSGSNPSNN PAARAQFHSP NGNGNGCATP PFTISSPTKA  180
VYDAATVASP VVAPGLYDVH NPGMMMGQHE RCQQAAIAMQ QGYPYVHNNG GGLLMNFRDQ  240
NAAGVHASMD FMNGSSNSSS SMEYAAGMPN GNVFNPGVAA FMDETAAMWA TVVEPGMGAG  300
IEMAHQHQQQ HGLGLEEVVG PPPRPLINGG SSGGKGLDIM DVSSEVYGSA GTTTAFDLEL  360
MESCGLFCGA AGNGMEQLQW DC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32131157108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040062e-50AP004006.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1197_D06.
GenBankAP0042592e-50AP004259.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0005E02.
GenBankAP0149632e-50AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126152e-50CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957753.11e-171PREDICTED: transcription factor MYB12-like
TrEMBLW5BNR20.0W5BNR2_WHEAT; Uncharacterized protein
STRINGMLOC_56753.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97513545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.16e-83myb domain protein 67
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]